Lineage for d1c5ka1 (1c5k A:163-431)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417861Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) (S)
  5. 2417862Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)
  6. 2417863Protein TolB, C-terminal domain [50962] (1 species)
  7. 2417864Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. 2417874Domain d1c5ka1: 1c5k A:163-431 [27630]
    Other proteins in same PDB: d1c5ka2
    complexed with yb

Details for d1c5ka1

PDB Entry: 1c5k (more details), 2 Å

PDB Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9
PDB Compounds: (A:) protein (tolb protein)

SCOPe Domain Sequences for d1c5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ka1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOPe Domain Coordinates for d1c5ka1:

Click to download the PDB-style file with coordinates for d1c5ka1.
(The format of our PDB-style files is described here.)

Timeline for d1c5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ka2