Lineage for d1c5da2 (1c5d A:107-213)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934293Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 934944Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries)
  8. 934951Domain d1c5da2: 1c5d A:107-213 [21386]
    Other proteins in same PDB: d1c5da1, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl1
    part of antibody against the main immunogenic region of the human muscle acetylcholine receptor

Details for d1c5da2

PDB Entry: 1c5d (more details), 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
PDB Compounds: (A:) monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOPe Domain Sequences for d1c5da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5da2 b.1.1.2 (A:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOPe Domain Coordinates for d1c5da2:

Click to download the PDB-style file with coordinates for d1c5da2.
(The format of our PDB-style files is described here.)

Timeline for d1c5da2: