Lineage for d1c4qa_ (1c4q A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 799053Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 799054Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 799055Domain d1c4qa_: 1c4q A: [25010]

Details for d1c4qa_

PDB Entry: 1c4q (more details), 1.52 Å

PDB Description: mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
PDB Compounds: (A:) protein (shiga-like toxin I subunit b)

SCOP Domain Sequences for d1c4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4qa_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1c4qa_:

Click to download the PDB-style file with coordinates for d1c4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1c4qa_: