Lineage for d1c4aa3 (1c4a A:127-209)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861105Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 861160Protein Fe-only hydrogenase, second domain [54885] (1 species)
  7. 861161Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries)
  8. 861165Domain d1c4aa3: 1c4a A:127-209 [39000]
    Other proteins in same PDB: d1c4aa1, d1c4aa2

Details for d1c4aa3

PDB Entry: 1c4a (more details), 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum
PDB Compounds: (A:) protein (fe-only hydrogenase)

SCOP Domain Sequences for d1c4aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4aa3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOP Domain Coordinates for d1c4aa3:

Click to download the PDB-style file with coordinates for d1c4aa3.
(The format of our PDB-style files is described here.)

Timeline for d1c4aa3: