Lineage for d1c4aa2 (1c4a A:1-126)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854326Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 854363Protein Fe-only hydrogenase, N-terminal domain [54313] (1 species)
  7. 854364Species Clostridium pasteurianum [TaxId:1501] [54314] (4 PDB entries)
  8. 854368Domain d1c4aa2: 1c4a A:1-126 [37692]
    Other proteins in same PDB: d1c4aa1, d1c4aa3

Details for d1c4aa2

PDB Entry: 1c4a (more details), 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum
PDB Compounds: (A:) protein (fe-only hydrogenase)

SCOP Domain Sequences for d1c4aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4aa2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]}
mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
skpflp

SCOP Domain Coordinates for d1c4aa2:

Click to download the PDB-style file with coordinates for d1c4aa2.
(The format of our PDB-style files is described here.)

Timeline for d1c4aa2: