Lineage for d1c3va2 (1c3v A:606-714)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
N-terminal domain is the classic Rossmann-fold
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) 
Protein Dihydrodipicolinate reductase [55371] (3 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [103104] (5 PDB entries) 
Domain d1c3va2: 1c3v A:606-714 [90412]
Other proteins in same PDB: d1c3va1, d1c3vb1
complexed with ndp, pdc, pg4
Details for d1c3va2
PDB Entry: 1c3v (more details), 2.39 Å
PDB Description: dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
PDB Compounds: (A:) dihydrodipicolinate reductaseSCOPe Domain Sequences for d1c3va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3va2 d.81.1.3 (A:606-714) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat
stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr
SCOPe Domain Coordinates for d1c3va2:
Click to download the PDB-style file with coordinates for d1c3va2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3va2:
- d1c3va2 first appeared in SCOP 1.67
- d1c3va2 appears in SCOPe 2.07
View in 3D
