Lineage for d1c3va1 (1c3v A:501-605,A:715-745)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828763Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 1828773Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries)
  8. 1828776Domain d1c3va1: 1c3v A:501-605,A:715-745 [90411]
    Other proteins in same PDB: d1c3va2, d1c3vb2
    complexed with ndp, pdc, pg4

Details for d1c3va1

PDB Entry: 1c3v (more details), 2.39 Å

PDB Description: dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1c3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3va1 c.2.1.3 (A:501-605,A:715-745) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri
aerpgltvgleplldlh

SCOPe Domain Coordinates for d1c3va1:

Click to download the PDB-style file with coordinates for d1c3va1.
(The format of our PDB-style files is described here.)

Timeline for d1c3va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c3va2