Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Dihydrodipicolinate reductase [51821] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries) |
Domain d1c3va1: 1c3v A:501-605,A:715-745 [90411] Other proteins in same PDB: d1c3va2, d1c3vb2 complexed with ndp, pdc, pg4 |
PDB Entry: 1c3v (more details), 2.39 Å
SCOPe Domain Sequences for d1c3va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3va1 c.2.1.3 (A:501-605,A:715-745) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri aerpgltvgleplldlh
Timeline for d1c3va1: