Lineage for d1c3va1 (1c3v A:501-605,A:715-745)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Dihydrodipicolinate reductase [51821] (3 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries) 
Domain d1c3va1: 1c3v A:501-605,A:715-745 [90411]
Other proteins in same PDB: d1c3va2, d1c3vb2
complexed with ndp, pdc, pg4
Details for d1c3va1
PDB Entry: 1c3v (more details), 2.39 Å
PDB Description: dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
PDB Compounds: (A:) dihydrodipicolinate reductaseSCOPe Domain Sequences for d1c3va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3va1 c.2.1.3 (A:501-605,A:715-745) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri
aerpgltvgleplldlh
SCOPe Domain Coordinates for d1c3va1:
Click to download the PDB-style file with coordinates for d1c3va1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3va1:
- d1c3va1 first appeared in SCOP 1.67
- d1c3va1 appears in SCOPe 2.02
- d1c3va1 appears in SCOPe 2.04
- d1c3va1 appears in the current release, SCOPe 2.08
View in 3D
