Lineage for d1c2aa2 (1c2a A:65-123)
- Root: SCOPe 2.06
Class g: Small proteins [56992] (94 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) 
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) 
Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
duplication: consists of two sequence repeats each having this fold- Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (1 PDB entry)
further duplication: consist of two BBI domains 
Domain d1c2aa2: 1c2a A:65-123 [44350]
Details for d1c2aa2
PDB Entry: 1c2a (more details), 1.9 Å
PDB Description: crystal structure of barley bbi
PDB Compounds: (A:) bowman-birk trypsin inhibitorSCOPe Domain Sequences for d1c2aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c2aa2 g.3.13.1 (A:65-123) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprct
SCOPe Domain Coordinates for d1c2aa2:
Click to download the PDB-style file with coordinates for d1c2aa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c2aa2:
- d1c2aa2 first appeared (with stable ids) in SCOP 1.55
- d1c2aa2 appears in SCOPe 2.05
- d1c2aa2 appears in SCOPe 2.07
- d1c2aa2 appears in the current release, SCOPe 2.08
View in 3D
