Lineage for d1c1ma_ (1c1m A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795358Protein Elastase [50536] (4 species)
  7. 2795385Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)
  8. 2795504Domain d1c1ma_: 1c1m A: [26275]
    complexed with ca, so4, xe

Details for d1c1ma_

PDB Entry: 1c1m (more details), 2.2 Å

PDB Description: porcine elastase under xenon pressure (8 bar)
PDB Compounds: (A:) protein (porcine elastase)

SCOPe Domain Sequences for d1c1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ma_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1c1ma_:

Click to download the PDB-style file with coordinates for d1c1ma_.
(The format of our PDB-style files is described here.)

Timeline for d1c1ma_: