Lineage for d1c1la_ (1c1l A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050578Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2050585Protein Congerin I [49942] (1 species)
  7. 2050586Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries)
  8. 2050587Domain d1c1la_: 1c1l A: [24219]

Details for d1c1la_

PDB Entry: 1c1l (more details), 1.5 Å

PDB Description: lactose-liganded congerin i
PDB Compounds: (A:) protein (congerin I)

SCOPe Domain Sequences for d1c1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster) [TaxId: 7943]}
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle

SCOPe Domain Coordinates for d1c1la_:

Click to download the PDB-style file with coordinates for d1c1la_.
(The format of our PDB-style files is described here.)

Timeline for d1c1la_: