Lineage for d1c1eh1 (1c1e H:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740454Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 2740462Domain d1c1eh1: 1c1e H:1-119 [20239]
    Other proteins in same PDB: d1c1eh2, d1c1el1, d1c1el2
    part of Diels-Alder catalytic Fab 1E9
    complexed with enh, mlt

Details for d1c1eh1

PDB Entry: 1c1e (more details), 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten
PDB Compounds: (H:) catalytic antibody 1e9 (heavy chain)

SCOPe Domain Sequences for d1c1eh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1eh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgymftnygmnwvkqapgkalklmgwinpytgestf
addfkgrfaffletsattaylqinnlknedmatyfcargttivramdywgqgtsltvssa
kttpp

SCOPe Domain Coordinates for d1c1eh1:

Click to download the PDB-style file with coordinates for d1c1eh1.
(The format of our PDB-style files is described here.)

Timeline for d1c1eh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1eh2