Lineage for d1c12a2 (1c12 A:108-214)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
Domain d1c12a2: 1c12 A:108-214 [21372]
Other proteins in same PDB: d1c12a1, d1c12b1, d1c12b2, d1c12b3
part of antibody directed against the musk odorant traseolide
complexed with trz
Details for d1c12a2
PDB Entry: 1c12 (more details), 2.6 Å
PDB Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide
PDB Compounds: (A:) protein (antibody fragment fab)SCOPe Domain Sequences for d1c12a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c12a2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnea
SCOPe Domain Coordinates for d1c12a2:
Click to download the PDB-style file with coordinates for d1c12a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c12a2:
- d1c12a2 first appeared (with stable ids) in SCOP 1.55
- d1c12a2 appears in SCOPe 2.07
View in 3D
