Lineage for d1c0fs_ (1c0f S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969712Domain d1c0fs_: 1c0f S: [40851]
    Other proteins in same PDB: d1c0fa1, d1c0fa2
    domain 1
    complexed with atp, ca

Details for d1c0fs_

PDB Entry: 1c0f (more details), 2.4 Å

PDB Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1
PDB Compounds: (S:) gelsolin segment 1

SCOPe Domain Sequences for d1c0fs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0fs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
ggvasgf

SCOPe Domain Coordinates for d1c0fs_:

Click to download the PDB-style file with coordinates for d1c0fs_.
(The format of our PDB-style files is described here.)

Timeline for d1c0fs_: