![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Endocellulase E1 [51497] (1 species) |
![]() | Species Acidothermus cellulolyticus [TaxId:28049] [51498] (3 PDB entries) |
![]() | Domain d1c0da_: 1c0d A: [302265] automated match to d1ecea_ mutant |
PDB Entry: 1c0d (more details), 2.4 Å
SCOPe Domain Sequences for d1c0da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0da_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv
Timeline for d1c0da_: