Lineage for d1c08b_ (1c08 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353587Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. 2353617Domain d1c08b_: 1c08 B: [19975]
    Other proteins in same PDB: d1c08a_, d1c08c_
    part of Fv HyHEL-10

Details for d1c08b_

PDB Entry: 1c08 (more details), 2.3 Å

PDB Description: crystal structure of hyhel-10 fv-hen lysozyme complex
PDB Compounds: (B:) anti-hen egg white lysozyme antibody (hyhel-10)

SCOPe Domain Sequences for d1c08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c08b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d1c08b_:

Click to download the PDB-style file with coordinates for d1c08b_.
(The format of our PDB-style files is described here.)

Timeline for d1c08b_: