Lineage for d1bzya_ (1bzy A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704043Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 704044Species Human (Homo sapiens) [TaxId:9606] [53284] (4 PDB entries)
  8. 704049Domain d1bzya_: 1bzy A: [34071]

Details for d1bzya_

PDB Entry: 1bzy (more details), 2 Å

PDB Description: human hgprtase with transition state inhibitor
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOP Domain Sequences for d1bzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzya_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

SCOP Domain Coordinates for d1bzya_:

Click to download the PDB-style file with coordinates for d1bzya_.
(The format of our PDB-style files is described here.)

Timeline for d1bzya_: