Lineage for d1bzda_ (1bzd A:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.3: Prealbumin-like [49451] (7 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common foldSuperfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) 
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein) Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
sandwich; 8 strands in 2 sheetsSpecies Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
Uniprot P02766 31-143
Domain d1bzda_: 1bzd A: [22575]
Details for d1bzda_
PDB Entry: 1bzd (more details), 1.9 Å
PDB Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation
PDB Compounds: (A:) protein (transthyretin)SCOP Domain Sequences for d1bzda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzda_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke
SCOP Domain Coordinates for d1bzda_:
Click to download the PDB-style file with coordinates for d1bzda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzda_:
- d1bzda_ first appeared (with stable ids) in SCOP 1.55
- d1bzda_ appears in SCOP 1.73
- d1bzda_ appears in SCOPe 2.01
- d1bzda_ appears in the current release, SCOPe 2.08
View in 3D
