| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins) contains PAC motif |
| Protein Erg potassium channel, N-terminal domain [55794] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55795] (1 PDB entry) |
| Domain d1bywa_: 1byw A: [40912] |
PDB Entry: 1byw (more details), 2.6 Å
SCOPe Domain Sequences for d1bywa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgpctqrraaaqiaqa
llgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevvmek
Timeline for d1bywa_: