Lineage for d1bxza2 (1bxz A:140-313)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. Species Thermoanaerobacter brockii [TaxId:29323] [51744] (3 PDB entries)
  8. Domain d1bxza2: 1bxz A:140-313 [29777]
    Other proteins in same PDB: d1bxza1, d1bxzb1, d1bxzc1, d1bxzd1
    complexed with cl, mg, sbt, zn

Details for d1bxza2

PDB Entry: 1bxz (more details), 2.99 Å

PDB Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
PDB Compounds: (A:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1bxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxza2 c.2.1.1 (A:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
ipleaavmipdmmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgs
rpvcvdaakyygatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpg
gtianvnyfgegevlpvprlewgcgmahktikgglcpggrlrmerlidlvfykr

SCOPe Domain Coordinates for d1bxza2 are not available.

Timeline for d1bxza2:

Domains from same chain:
(mouse over for more information)
d1bxza1
Domains from other chains:
(mouse over for more information)
d1bxzb1, d1bxzb2, d1bxzc1, d1bxzc2, d1bxzd1, d1bxzd2