| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
| Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
| Protein Prokaryotic ribosomal protein L30 [55131] (3 species) short-chain member of the family |
| Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries) |
| Domain d1bxya_: 1bxy A: [39525] |
PDB Entry: 1bxy (more details), 1.9 Å
SCOP Domain Sequences for d1bxya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxya_ d.59.1.1 (A:) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
Timeline for d1bxya_: