Lineage for d1bxta2 (1bxt A:120-234)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717998Protein Streptococcal superantigen SSA [54354] (1 species)
  7. 717999Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries)
  8. 718001Domain d1bxta2: 1bxt A:120-234 [37799]
    Other proteins in same PDB: d1bxta1, d1bxtb1

Details for d1bxta2

PDB Entry: 1bxt (more details), 1.85 Å

PDB Description: streptococcal superantigen (ssa) from streptococcus pyogenes
PDB Compounds: (A:) protein (streptococcal superantigen)

SCOP Domain Sequences for d1bxta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxta2 d.15.6.1 (A:120-234) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
qiegkfpnitvkvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspye
tgyikfiessgdsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk

SCOP Domain Coordinates for d1bxta2:

Click to download the PDB-style file with coordinates for d1bxta2.
(The format of our PDB-style files is described here.)

Timeline for d1bxta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxta1