![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (5 species) |
![]() | Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries) |
![]() | Domain d1bxea_: 1bxe A: [38898] complexed with cl |
PDB Entry: 1bxe (more details), 1.9 Å
SCOPe Domain Sequences for d1bxea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxea_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d1bxea_: