Lineage for d1bwza2 (1bwz A:131-274)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) 
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) Protein Diaminopimelate epimerase [54508] (1 species) Species Haemophilus influenzae [TaxId:727] [54509] (4 PDB entries) 
Domain d1bwza2: 1bwz A:131-274 [38338]
Details for d1bwza2
PDB Entry: 1bwz (more details), 2.72 Å
PDB Description: diaminopimelate epimerase from hemophilus influenzae
PDB Compounds: (A:) protein (diaminopimelate epimerase)SCOP Domain Sequences for d1bwza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwza2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl
SCOP Domain Coordinates for d1bwza2:
Click to download the PDB-style file with coordinates for d1bwza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwza2:
- d1bwza2 first appeared (with stable ids) in SCOP 1.55
- d1bwza2 appears in SCOP 1.71
- d1bwza2 appears in SCOP 1.75
- d1bwza2 appears in the current release, SCOPe 2.08
View in 3D
