Lineage for d1bwza1 (1bwz A:1-130)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) 
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
automatically mapped to Pfam PF01678Protein Diaminopimelate epimerase [54508] (3 species) Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries) 
Domain d1bwza1: 1bwz A:1-130 [38337]
Details for d1bwza1
PDB Entry: 1bwz (more details), 2.72 Å
PDB Description: diaminopimelate epimerase from hemophilus influenzae
PDB Compounds: (A:) protein (diaminopimelate epimerase)SCOPe Domain Sequences for d1bwza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwza1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkdmnqirvnmge
piwepakipf
SCOPe Domain Coordinates for d1bwza1:
Click to download the PDB-style file with coordinates for d1bwza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwza1:
- d1bwza1 first appeared (with stable ids) in SCOP 1.55
- d1bwza1 appears in SCOPe 2.07
View in 3D
