Lineage for d1bwxa_ (1bwx A:)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 899611Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. 899612Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. 899613Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. 899614Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)
  7. 899617Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. 899622Domain d1bwxa_: 1bwx A: [46155]

Details for d1bwxa_

PDB Entry: 1bwx (more details)

PDB Description: the solution structure of human parathyroid hormone fragment 1-39, nmr, 10 structures
PDB Compounds: (A:) parathyroid hormone

SCOP Domain Sequences for d1bwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwxa_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga

SCOP Domain Coordinates for d1bwxa_:

Click to download the PDB-style file with coordinates for d1bwxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bwxa_: