![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily) |
![]() | Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) ![]() |
![]() | Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein) |
![]() | Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries) |
![]() | Domain d1bwxa_: 1bwx A: [46155] |
PDB Entry: 1bwx (more details)
SCOPe Domain Sequences for d1bwxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwxa_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]} svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga
Timeline for d1bwxa_: