Lineage for d1bw5a_ (1bw5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981565Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1981657Protein Insulin gene enhancer protein isl-1 [46714] (1 species)
  7. 1981658Species Norway rat (Rattus norvegicus) [TaxId:10116] [46715] (1 PDB entry)
  8. 1981659Domain d1bw5a_: 1bw5 A: [16003]

Details for d1bw5a_

PDB Entry: 1bw5 (more details)

PDB Description: the nmr solution structure of the homeodomain of the rat insulin gene enhancer protein isl-1, 50 structures
PDB Compounds: (A:) insulin gene enhancer protein isl-1

SCOPe Domain Sequences for d1bw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mkttrvrtvlnekqlhtlrtcyaanprpdalmkeqlvemtglsprvirvwfqnkrckdkk
rsimmk

SCOPe Domain Coordinates for d1bw5a_:

Click to download the PDB-style file with coordinates for d1bw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1bw5a_: