Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Insulin gene enhancer protein isl-1 [46714] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [46715] (1 PDB entry) |
Domain d1bw5a_: 1bw5 A: [16003] |
PDB Entry: 1bw5 (more details)
SCOPe Domain Sequences for d1bw5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mkttrvrtvlnekqlhtlrtcyaanprpdalmkeqlvemtglsprvirvwfqnkrckdkk rsimmk
Timeline for d1bw5a_: