Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) share the common active site structure with the family II |
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins) |
Protein Tyrosine phosphatase [52790] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [52791] (5 PDB entries) |
Domain d1bvh__: 1bvh - [32640] |
PDB Entry: 1bvh (more details)
SCOP Domain Sequences for d1bvh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvh__ c.44.1.1 (-) Tyrosine phosphatase {Cow (Bos taurus)} aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd pqkqliiedpyygndadfetvyqqcvrccraflekvr
Timeline for d1bvh__: