Lineage for d1bvh__ (1bvh -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584193Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 584194Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 584195Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 584216Protein Tyrosine phosphatase [52790] (4 species)
  7. 584224Species Cow (Bos taurus) [TaxId:9913] [52791] (5 PDB entries)
  8. 584230Domain d1bvh__: 1bvh - [32640]

Details for d1bvh__

PDB Entry: 1bvh (more details)

PDB Description: solution structure of a low molecular weight protein tyrosine phosphatase

SCOP Domain Sequences for d1bvh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvh__ c.44.1.1 (-) Tyrosine phosphatase {Cow (Bos taurus)}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

SCOP Domain Coordinates for d1bvh__:

Click to download the PDB-style file with coordinates for d1bvh__.
(The format of our PDB-style files is described here.)

Timeline for d1bvh__: