Lineage for d1buoa_ (1buo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945727Protein Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain [54697] (1 species)
  7. 2945728Species Human (Homo sapiens) [TaxId:9606] [54698] (2 PDB entries)
  8. 2945729Domain d1buoa_: 1buo A: [38631]
    has additional insertions and/or extensions that are not grouped together

Details for d1buoa_

PDB Entry: 1buo (more details), 1.9 Å

PDB Description: btb domain from plzf
PDB Compounds: (A:) protein (promyelocytic leukemia zinc finger protein plzf)

SCOPe Domain Sequences for d1buoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
mgmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhr
nsqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmleti
q

SCOPe Domain Coordinates for d1buoa_:

Click to download the PDB-style file with coordinates for d1buoa_.
(The format of our PDB-style files is described here.)

Timeline for d1buoa_: