Lineage for d1buca1 (1buc A:233-383)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) 
multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins) 
Protein Butyryl-CoA dehydrogenase, C-domain [47205] (2 species) 
Species Megasphaera elsdenii [TaxId:907] [47206] (1 PDB entry) 
Domain d1buca1: 1buc A:233-383 [16590]
Other proteins in same PDB: d1buca2, d1bucb2
complexed with caa, fad
Details for d1buca1
PDB Entry: 1buc (more details), 2.5 Å
PDB Description: three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii
PDB Compounds: (A:) butyryl-coa dehydrogenaseSCOPe Domain Sequences for d1buca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]}
gkgfkiammtldggrigvaaqalgiaeaaladaveyskqrvqfgkplckfqsisfkladm
kmqieaarnlvykaackkqegkpftvdaaiakrvasdvamrvtteavqifggygyseeyp
varhmrdakitqiyegtnevqlmvtggallr
SCOPe Domain Coordinates for d1buca1:
Click to download the PDB-style file with coordinates for d1buca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buca1:
- d1buca1 first appeared (with stable ids) in SCOP 1.55
- d1buca1 appears in SCOPe 2.03
- d1buca1 appears in SCOPe 2.05
- d1buca1 appears in the current release, SCOPe 2.08
View in 3D
