![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins) automatically mapped to Pfam PF00151 |
![]() | Protein Pancreatic lipase, N-terminal domain [53578] (6 species) contains additional, colipase-binding domain |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [53584] (1 PDB entry) pancreatic lipase related protein 2 |
![]() | Domain d1bu8a2: 1bu8 A:1-336 [34795] Other proteins in same PDB: d1bu8a1 complexed with nag |
PDB Entry: 1bu8 (more details), 1.8 Å
SCOPe Domain Sequences for d1bu8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp cpeegcpkmghyadqfegktatveqtvylntgdsgnft
Timeline for d1bu8a2: