Lineage for d1bu8a2 (1bu8 A:1-336)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins)
automatically mapped to Pfam PF00151Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
contains additional, colipase-binding domainSpecies Norway rat (Rattus norvegicus) [TaxId:10116] [53584] (1 PDB entry)
pancreatic lipase related protein 2
Domain d1bu8a2: 1bu8 A:1-336 [34795]
Other proteins in same PDB: d1bu8a1
complexed with nag
Details for d1bu8a2
PDB Entry: 1bu8 (more details), 1.8 Å
PDB Description: rat pancreatic lipase related protein 2
PDB Compounds: (A:) protein (pancreatic lipase related protein 2)SCOPe Domain Sequences for d1bu8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt
ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas
yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa
epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq
knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp
cpeegcpkmghyadqfegktatveqtvylntgdsgnft
SCOPe Domain Coordinates for d1bu8a2:
Click to download the PDB-style file with coordinates for d1bu8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bu8a2:
View in 3D
