Lineage for d1btea_ (1bte A:)
- Root: SCOP 1.73
Class g: Small proteins [56992] (85 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily)
disulfide-rich fold: nearly all-betaSuperfamily g.7.1: Snake toxin-like [57302] (3 families) 
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins) 
Protein Type II activin receptor [57357] (3 species) Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries) 
Domain d1btea_: 1bte A: [44463]
Details for d1btea_
PDB Entry: 1bte (more details), 1.5 Å
PDB Description: crystal structure of the extracellular domain of the type ii activin receptor
PDB Compounds: (A:) protein (activin receptor type II)SCOP Domain Sequences for d1btea_:
Sequence, based on SEQRES records: (download)
>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpeme
Sequence, based on observed residues (ATOM records): (download)
>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygrrhcfatwknisgsieivkqgcwlddincydrt
dciekkdspevyfcccegnmcnekfsyfpeme
SCOP Domain Coordinates for d1btea_:
Click to download the PDB-style file with coordinates for d1btea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btea_:
- d1btea_ first appeared (with stable ids) in SCOP 1.55
- d1btea_ appears in SCOP 1.71
- d1btea_ appears in SCOP 1.75
- d1btea_ appears in the current release, SCOPe 2.08
View in 3D
