Lineage for d1brza_ (1brz A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1960727Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1961020Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 1961027Protein Brazzein [57178] (1 species)
    sweet protein
  7. 1961028Species J'oublie (Pentadiplandra brazzeana) [TaxId:43545] [57179] (6 PDB entries)
  8. 1961033Domain d1brza_: 1brz A: [44179]

Details for d1brza_

PDB Entry: 1brz (more details)

PDB Description: solution structure of the sweet protein brazzein, nmr, 43 structures
PDB Compounds: (A:) brazzein

SCOPe Domain Sequences for d1brza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brza_ g.3.7.5 (A:) Brazzein {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]}
edkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey

SCOPe Domain Coordinates for d1brza_:

Click to download the PDB-style file with coordinates for d1brza_.
(The format of our PDB-style files is described here.)

Timeline for d1brza_: