Lineage for d1brpa_ (1brp A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein Retinol binding protein [50816] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50819] (17 PDB entries)
  8. Domain d1brpa_: 1brp A: [27086]
    complexed with rtl

Details for d1brpa_

PDB Entry: 1brp (more details), 2.5 Å

PDB Description: crystal structure of the trigonal form of human plasma retinol-binding protein at 2.5 angstroms resolution
PDB Compounds: (A:) retinol binding protein

SCOPe Domain Sequences for d1brpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brpa_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd

SCOPe Domain Coordinates for d1brpa_ are not available.

Timeline for d1brpa_: