Lineage for d1broa_ (1bro A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508150Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2508162Protein Bromoperoxidase A2 [53532] (1 species)
  7. 2508163Species Streptomyces aureofaciens [TaxId:1894] [53533] (2 PDB entries)
  8. 2508165Domain d1broa_: 1bro A: [34700]

Details for d1broa_

PDB Entry: 1bro (more details), 2.05 Å

PDB Description: bromoperoxidase a2
PDB Compounds: (A:) bromoperoxidase a2

SCOPe Domain Sequences for d1broa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1broa_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}
pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak

SCOPe Domain Coordinates for d1broa_:

Click to download the PDB-style file with coordinates for d1broa_.
(The format of our PDB-style files is described here.)

Timeline for d1broa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1brob_