Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.3: TIMP-like [50242] (4 families) |
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) contains an irregular alpha+beta subdomain in the C-terminal extension automatically mapped to Pfam PF00965 |
Protein TIMP-2 [50246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50247] (4 PDB entries) |
Domain d1br9a_: 1br9 A: [25235] |
PDB Entry: 1br9 (more details), 2.1 Å
SCOPe Domain Sequences for d1br9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1br9a_ b.40.3.1 (A:) TIMP-2 {Human (Homo sapiens) [TaxId: 9606]} cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg aa
Timeline for d1br9a_: