| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Myosin Essential Chain [47524] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [47526] (4 PDB entries) |
| Domain d1br1b_: 1br1 B: [17309] Other proteins in same PDB: d1br1a1, d1br1a2, d1br1c1, d1br1c2, d1br1e1, d1br1e2, d1br1g1, d1br1g2 complexed with adp, alf, mg |
PDB Entry: 1br1 (more details), 3.5 Å
SCOPe Domain Sequences for d1br1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1br1b_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg
Timeline for d1br1b_: