Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries) |
Domain d1bqqm_: 1bqq M: [40406] Other proteins in same PDB: d1bqqt_ complexed with ca, zn |
PDB Entry: 1bqq (more details), 2.75 Å
SCOPe Domain Sequences for d1bqqm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges
Timeline for d1bqqm_: