| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.4: Clathrin heavy-chain linker domain [48393] (1 protein) this is a repeat family; one repeat unit is 1bpo B:444-471 found in domain |
| Protein Clathrin heavy-chain linker domain [48394] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [48395] (5 PDB entries) |
| Domain d1bpoa1: 1bpo A:331-487 [19143] Other proteins in same PDB: d1bpoa2, d1bpob2, d1bpoc2 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1bpo (more details), 2.6 Å
SCOPe Domain Sequences for d1bpoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeniipyitnvlqnpdlalrmavrnnlagaeelfarkfnalfaqgnyseaakvaanapkg
ilrtpdtirrfqsvpaqpgqtspllqyfgilldqgqlnkyeslelcrpvlqqgrkqllek
wlkedklecseelgdlvksvdptlalsvylranvpnk
Timeline for d1bpoa1:
View in 3DDomains from other chains: (mouse over for more information) d1bpob1, d1bpob2, d1bpoc1, d1bpoc2 |