Lineage for d1bosa_ (1bos A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. Species Escherichia coli [TaxId:562] [50211] (17 PDB entries)
  8. Domain d1bosa_: 1bos A: [25075]
    complexed with bgc, gal, gla

Details for d1bosa_

PDB Entry: 1bos (more details), 2.8 Å

PDB Description: shiga-like toxin complexed with its receptor
PDB Compounds: (A:) shiga-like toxin I b subunit

SCOPe Domain Sequences for d1bosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bosa_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1bosa_ are not available.

Timeline for d1bosa_: