Lineage for d1bola_ (1bol A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974241Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2974242Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2974243Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2974259Protein Ribonuclease Rh [55897] (1 species)
  7. 2974260Species Rhizopus niveus [TaxId:4844] [55898] (1 PDB entry)
  8. 2974261Domain d1bola_: 1bol A: [41120]

Details for d1bola_

PDB Entry: 1bol (more details), 2 Å

PDB Description: the crystal structure of ribonuclease rh from rhizopus niveus at 2.0 a resolution
PDB Compounds: (A:) protein (ribonuclease rh)

SCOPe Domain Sequences for d1bola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bola_ d.124.1.1 (A:) Ribonuclease Rh {Rhizopus niveus [TaxId: 4844]}
sscsstalscsnsansdtccspeyglvvlnmqwapgygpdnaftlhglwpdkcsgayaps
ggcdsnrasssiasvikskdsslynsmltywpsnqgnnnvfwshewskhgtcvstydpdc
ydnyeegedivdyfqkamdlrsqynvykafssngitpggtytatemqsaiesyfgakaki
dcssgtlsdvalyfyvrgrdtyvitdalstgscsgdveyptk

SCOPe Domain Coordinates for d1bola_:

Click to download the PDB-style file with coordinates for d1bola_.
(The format of our PDB-style files is described here.)

Timeline for d1bola_: