Lineage for d1bnba_ (1bnb A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890710Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 890711Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 890712Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 890726Protein Beta-defensin, BD [63384] (7 species)
  7. 890727Species Cow (Bos taurus), BD12 [TaxId:9913] [63386] (1 PDB entry)
  8. 890728Domain d1bnba_: 1bnb A: [44592]

Details for d1bnba_

PDB Entry: 1bnb (more details)

PDB Description: solution structure of bovine neutrophil beta-defensin 12: the peptide fold of the beta-defensins is identical to that of the classical defensins
PDB Compounds: (A:) bovine neutrophil beta-defensin 12

SCOP Domain Sequences for d1bnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnba_ g.9.1.1 (A:) Beta-defensin, BD {Cow (Bos taurus), BD12 [TaxId: 9913]}
aplscgrnggvcipircpvpmrqigtcfgrpvkccrsw

SCOP Domain Coordinates for d1bnba_:

Click to download the PDB-style file with coordinates for d1bnba_.
(The format of our PDB-style files is described here.)

Timeline for d1bnba_: