Lineage for d1bmka_ (1bmk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930891Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1930892Species Human (Homo sapiens) [TaxId:9606] [56130] (162 PDB entries)
  8. 1931014Domain d1bmka_: 1bmk A: [41644]
    complexed with sb5

Details for d1bmka_

PDB Entry: 1bmk (more details), 2.4 Å

PDB Description: the complex structure of the map kinase p38/sb218655
PDB Compounds: (A:) protein (map kinase p38)

SCOPe Domain Sequences for d1bmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmka_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

SCOPe Domain Coordinates for d1bmka_:

Click to download the PDB-style file with coordinates for d1bmka_.
(The format of our PDB-style files is described here.)

Timeline for d1bmka_: