![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries) |
![]() | Domain d1bmga_: 1bmg A: [20667] |
PDB Entry: 1bmg (more details), 2.5 Å
SCOPe Domain Sequences for d1bmga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmga_ b.1.1.2 (A:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]} iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
Timeline for d1bmga_: