Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK6 [88859] (1 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [88860] (13 PDB entries) |
Domain d1blxa_: 1blx A: [41596] Other proteins in same PDB: d1blxb_ complexed with ca |
PDB Entry: 1blx (more details), 1.9 Å
SCOPe Domain Sequences for d1blxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} glcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevav lrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikd mmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlw yrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwp rdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdle rcken
Timeline for d1blxa_: