Lineage for d1blxa_ (1blx A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930210Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1930211Species Human (Homo sapiens) [TaxId:9606] [88860] (13 PDB entries)
  8. 1930212Domain d1blxa_: 1blx A: [41596]
    Other proteins in same PDB: d1blxb_
    complexed with ca

Details for d1blxa_

PDB Entry: 1blx (more details), 1.9 Å

PDB Description: p19ink4d/cdk6 complex
PDB Compounds: (A:) cyclin-dependent kinase 6

SCOPe Domain Sequences for d1blxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
glcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevav
lrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikd
mmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlw
yrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwp
rdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdle
rcken

SCOPe Domain Coordinates for d1blxa_:

Click to download the PDB-style file with coordinates for d1blxa_.
(The format of our PDB-style files is described here.)

Timeline for d1blxa_: