Lineage for d1blsa_ (1bls A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618365Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2618394Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (10 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 2618403Domain d1blsa_: 1bls A: [42741]
    complexed with ipp

Details for d1blsa_

PDB Entry: 1bls (more details), 2.3 Å

PDB Description: crystallographic structure of a phosphonate derivative of the enterobacter cloacae p99 cephalosporinase: mechanistic interpretation of a beta-lactamase transition state analog
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1blsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blsa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

SCOPe Domain Coordinates for d1blsa_:

Click to download the PDB-style file with coordinates for d1blsa_.
(The format of our PDB-style files is described here.)

Timeline for d1blsa_:

2618403
d1blsa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1blsb_