Lineage for d1bl3c_ (1bl3 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2493949Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2493955Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)
  8. 2494005Domain d1bl3c_: 1bl3 C: [33657]
    complexed with mg

Details for d1bl3c_

PDB Entry: 1bl3 (more details), 2 Å

PDB Description: catalytic domain of hiv-1 integrase
PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d1bl3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl3c_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
ehlktavqmavfihnhkrkggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d1bl3c_:

Click to download the PDB-style file with coordinates for d1bl3c_.
(The format of our PDB-style files is described here.)

Timeline for d1bl3c_: