Lineage for d1bk1a_ (1bk1 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389774Species Aspergillus kawachii [TaxId:40384] [49988] (4 PDB entries)
    Uniprot P55328 29-210 # 100% sequence identity; Aspergillus awamori TaxID: 105351
  8. 2389779Domain d1bk1a_: 1bk1 A: [24340]

Details for d1bk1a_

PDB Entry: 1bk1 (more details), 2 Å

PDB Description: endo-1,4-beta-xylanase c
PDB Compounds: (A:) endo-1,4-b-xylanase c

SCOPe Domain Sequences for d1bk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk1a_ b.29.1.11 (A:) Xylanase II {Aspergillus kawachii [TaxId: 40384]}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
is

SCOPe Domain Coordinates for d1bk1a_:

Click to download the PDB-style file with coordinates for d1bk1a_.
(The format of our PDB-style files is described here.)

Timeline for d1bk1a_: