Lineage for d1bjza2 (1bjz A:68-208)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) Species Escherichia coli [TaxId:562] [48501] (23 PDB entries) 
Domain d1bjza2: 1bjz A:68-208 [19242]
Other proteins in same PDB: d1bjza1
Details for d1bjza2
PDB Entry: 1bjz (more details), 2.2 Å
PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction
PDB Compounds: (A:) tetracycline repressorSCOPe Domain Sequences for d1bjza2:
Sequence, based on SEQRES records: (download)
>d1bjza2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Sequence, based on observed residues (ATOM records): (download)
>d1bjza2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehnlppllrealqimdsddgeqaflhgleslirgfevq
ltallqiv
SCOPe Domain Coordinates for d1bjza2:
Click to download the PDB-style file with coordinates for d1bjza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bjza2:
- d1bjza2 first appeared (with stable ids) in SCOP 1.55, called d1bjz_2
- d1bjza2 appears in SCOPe 2.04
- d1bjza2 appears in SCOPe 2.06
- d1bjza2 appears in the current release, SCOPe 2.08
View in 3D
